SwissProt::Q5XKL5 has 1792 amino acids
Query: BTBD8_C [M=46]
Accession: PF15363.11
Description: BTB/POZ domain-containing protein 8, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-28 85.4 5.6 1.2e-27 82.3 5.6 2.9 1 SwissProt::Q5XKL5
Domain annotation for each sequence (and alignments):
>> SwissProt::Q5XKL5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.3 5.6 1.2e-27 1.2e-27 1 46 [] 1749 1792 .] 1749 1792 .] 0.98
Alignments for each domain:
== domain 1 score: 82.3 bits; conditional E-value: 1.2e-27
BTBD8_C 1 dtlsrwsELsSPlddssaSitvtsfssedgcSpqGeWTilELETqH 46
dtl+rwsEL SPld ssaSit++sfssed+ SpqGeWTilELETqH
SwissProt::Q5XKL5 1749 DTLNRWSELTSPLD-SSASITMASFSSEDC-SPQGEWTILELETQH 1792
9************7.78*************.*************** PP
Or compare SwissProt::Q5XKL5 to CDD or PaperBLAST