PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q5XKL5 to PF15363 (BTBD8_C)

SwissProt::Q5XKL5 has 1792 amino acids

Query:       BTBD8_C  [M=46]
Accession:   PF15363.11
Description: BTB/POZ domain-containing protein 8, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.3e-28   85.4   5.6    1.2e-27   82.3   5.6    2.9  1  SwissProt::Q5XKL5  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q5XKL5  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.3   5.6   1.2e-27   1.2e-27       1      46 []    1749    1792 .]    1749    1792 .] 0.98

  Alignments for each domain:
  == domain 1  score: 82.3 bits;  conditional E-value: 1.2e-27
            BTBD8_C    1 dtlsrwsELsSPlddssaSitvtsfssedgcSpqGeWTilELETqH 46  
                         dtl+rwsEL SPld ssaSit++sfssed+ SpqGeWTilELETqH
  SwissProt::Q5XKL5 1749 DTLNRWSELTSPLD-SSASITMASFSSEDC-SPQGEWTILELETQH 1792
                         9************7.78*************.*************** PP



Or compare SwissProt::Q5XKL5 to CDD or PaperBLAST