SwissProt::Q6ASS9 has 123 amino acids
Query: KxDL [M=86]
Accession: PF10241.13
Description: Uncharacterized conserved protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-30 90.5 0.0 4.5e-30 90.2 0.0 1.1 1 SwissProt::Q6ASS9
Domain annotation for each sequence (and alignments):
>> SwissProt::Q6ASS9
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 90.2 0.0 4.5e-30 4.5e-30 1 86 [] 18 103 .. 18 103 .. 0.99
Alignments for each domain:
== domain 1 score: 90.2 bits; conditional E-value: 4.5e-30
KxDL 1 rlssavdsedldeilalQaqtsgrlnkknreLlelnalsqerlaklrarfkqgtkllkevkkdLesifkkirslkaklakkyPeeY 86
r+ s+vd+ d+ +i ++Q+ ++grl+++n+ L+++n++s++++a+++++f+ +t+llk++k+dL++if k+rs+k++la++yP+++
SwissProt::Q6ASS9 18 RFRSLVDTGDIGAIRQTQHLILGRLQDSNAVLTHFNEYSEQCFAEVSNDFASKTRLLKSMKDDLDHIFLKLRSMKSRLAATYPDAF 103
6899********************************************************************************98 PP
Or compare SwissProt::Q6ASS9 to CDD or PaperBLAST