PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q6ICC9 to PF16297 (DUF4939)

SwissProt::Q6ICC9 has 239 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    6.2e-25   73.6   0.0      1e-24   72.8   0.0    1.3  1  SwissProt::Q6ICC9  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q6ICC9  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   72.8   0.0     1e-24     1e-24      22     103 ..      96     177 ..      84     179 .. 0.94

  Alignments for each domain:
  == domain 1  score: 72.8 bits;  conditional E-value: 1e-24
            DUF4939  22 rnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeef 103
                          p   pe f+G+ +rl  f++q   +m+ +  +f  +a +vafl++rl+G+a++w++p++q dspl nny++fl+e+++++
  SwissProt::Q6ICC9  96 TPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTY 177
                        568899***********************************************************************99875 PP



Or compare SwissProt::Q6ICC9 to CDD or PaperBLAST