SwissProt::Q8BG21 has 171 amino acids
Query: Cg6151-P [M=113] Accession: PF10233.13 Description: Uncharacterized conserved protein CG6151-P Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-34 103.9 6.8 3.9e-34 103.6 6.8 1.1 1 SwissProt::Q8BG21 Domain annotation for each sequence (and alignments): >> SwissProt::Q8BG21 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.6 6.8 3.9e-34 3.9e-34 2 113 .] 34 142 .. 33 142 .. 0.97 Alignments for each domain: == domain 1 score: 103.6 bits; conditional E-value: 3.9e-34 Cg6151-P 2 GilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatsliv 93 G+l+++ c + G++n +t+++++i++++++++++f++l++E+P+++++++++++++e ++++ + w++a++Y++ma+v+ +++ ++++++ SwissProt::Q8BG21 34 GVLGAVSCAISGLFNCVTIHPLNIAAGVWMIMNAFILLLCEAPFCCQFVEFANTVAEKVDRL-RSWQKAVFYCGMAIVP-IVMS-LTLTTLL 122 9**************99*********************************************.****************.6666.79***** PP Cg6151-P 94 aavlllitavlYglaalkkq 113 +++++++t+vlYgl al+k+ SwissProt::Q8BG21 123 GNAIAFATGVLYGLSALGKK 142 *****************997 PP
Or compare SwissProt::Q8BG21 to CDD or PaperBLAST