SwissProt::Q8C624 has 132 amino acids
Query: DUF4609 [M=68]
Accession: PF15382.10
Description: Domain of unknown function (DUF4609)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-43 132.9 1.7 1.5e-43 132.9 1.7 1.9 2 SwissProt::Q8C624
Domain annotation for each sequence (and alignments):
>> SwissProt::Q8C624
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.1 0.4 0.1 0.1 27 39 .. 19 31 .. 6 46 .. 0.58
2 ! 132.9 1.7 1.5e-43 1.5e-43 1 68 [] 63 130 .. 63 130 .. 0.98
Alignments for each domain:
== domain 1 score: -1.1 bits; conditional E-value: 0.1
DUF4609 27 EtlisysstgseE 39
tl++ s + E
SwissProt::Q8C624 19 TTLVTKSKEKVME 31
3444443333333 PP
== domain 2 score: 132.9 bits; conditional E-value: 1.5e-43
DUF4609 1 ekpdvkqksskKkvviPqiiitraSnEtlisysstgseEqrtirEqadwGpysRHRnPStvdAynlqt 68
+kp++kq+sskK++viPqiiitraSnEtlisy++ +++EqrtirE+adwGpy+RHR+PSt++Ay++++
SwissProt::Q8C624 63 DKPETKQRSSKKRSVIPQIIITRASNETLISYGIPDNDEQRTIREHADWGPYHRHRSPSTIAAYDVHN 130
79***************************************************************985 PP
Or compare SwissProt::Q8C624 to CDD or PaperBLAST