SwissProt::Q8CHH5 has 1074 amino acids
Query: GLTSCR1 [M=102]
Accession: PF15249.10
Description: Conserved region of unknown function on GLTSCR protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-36 111.2 2.7 3.4e-36 110.1 2.7 1.6 1 SwissProt::Q8CHH5
Domain annotation for each sequence (and alignments):
>> SwissProt::Q8CHH5
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 110.1 2.7 3.4e-36 3.4e-36 1 102 [] 708 808 .. 708 808 .. 0.98
Alignments for each domain:
== domain 1 score: 110.1 bits; conditional E-value: 3.4e-36
GLTSCR1 1 dqkavlnPdvktpFasleDAvkRLlPYHvfqepkedeedlekadeefekvatellkrfqkllnkyrrlllreskrespseeevmlerlllee 92
dq ++++Pd k+ F+sl+D v+RLl YHv+q+ ++eedl ++d+efe+vat+llkr+q++lnkyr lll++++r +ps+e+vm++r++++e
SwissProt::Q8CHH5 708 DQAHAVTPD-KSQFRSLNDTVQRLLSYHVCQGSMPTEEDLRQVDNEFEEVATQLLKRTQAMLNKYRFLLLEDAMRINPSAEMVMIDRMFNQE 798
899******.99******************************************************************************** PP
GLTSCR1 93 eraeleelkr 102
era+l+++kr
SwissProt::Q8CHH5 799 ERASLSRDKR 808
******9986 PP
Or compare SwissProt::Q8CHH5 to CDD or PaperBLAST