SwissProt::Q8Q0D6 has 123 amino acids
Query: DUF2283 [M=49]
Accession: PF10049.13
Description: Protein of unknown function (DUF2283)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-14 40.7 6.6 1.3e-14 40.5 5.2 1.8 2 SwissProt::Q8Q0D6
Domain annotation for each sequence (and alignments):
>> SwissProt::Q8Q0D6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 40.5 5.2 1.3e-14 1.3e-14 1 49 [] 9 56 .. 9 56 .. 0.98
2 ? -1.1 0.0 0.12 0.12 18 25 .. 74 81 .. 68 98 .. 0.66
Alignments for each domain:
== domain 1 score: 40.5 bits; conditional E-value: 1.3e-14
DUF2283 1 kitYDpeaDaLYIrlsegeveeseeiddgiildyDedGrivGIEilnAS 49
k++YD e+D+++ + s++++++s + dgiild+ ed++i IEil+AS
SwissProt::Q8Q0D6 9 KYDYDFENDSIFFYGSNKKYRSSID-LDGIILDIGEDDQIMAIEILDAS 56
789**********************.9*********************8 PP
== domain 2 score: -1.1 bits; conditional E-value: 0.12
DUF2283 18 geveesee 25
+++e see
SwissProt::Q8Q0D6 74 ARIEVSEE 81
44555555 PP
Or compare SwissProt::Q8Q0D6 to CDD or PaperBLAST