SwissProt::Q91ZP6 has 311 amino acids
Query: DUF2370 [M=224] Accession: PF10176.13 Description: Protein of unknown function (DUF2370) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-13 37.0 7.4 3.2e-10 26.1 0.0 3.2 3 SwissProt::Q91ZP6 Domain annotation for each sequence (and alignments): >> SwissProt::Q91ZP6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 2.3 2.6 0.006 0.006 38 76 .. 104 148 .. 70 158 .. 0.79 2 ! 26.1 0.0 3.2e-10 3.2e-10 39 128 .. 157 254 .. 151 262 .. 0.88 3 ! 9.9 0.2 3e-05 3e-05 186 221 .. 267 302 .. 254 305 .. 0.88 Alignments for each domain: == domain 1 score: 2.3 bits; conditional E-value: 0.006 DUF2370 38 ekpPtYeeAaa......DaaPpYwettilapglesdevlvdglpv 76 + Pt e+Aa D+ PpY +t+ ap++++ +v+ + pv SwissProt::Q91ZP6 104 LAAPTVEAAASapaldpDSPPPYSSITVEAPTTSDTDVYSEFYPV 148 55677777764444445999***************9*99887666 PP == domain 2 score: 26.1 bits; conditional E-value: 3.2e-10 DUF2370 39 kpPtYeeAaaDaaPpYwettilapgles.......devl.vdglpvGnifsfvwNllvsvsFqlvGFlltYlLHtthAakqGSraGLGitli 122 + PtY+eA + a + ap+ ++ d+ v+ l vGn f+ +++ F +GF l++ + t A + G+ G G+ li SwissProt::Q91ZP6 157 SLPTYDEAEKAKAAALAAAAADAPQRNQeedctprDDFSdVEQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLI 248 67999999999999999999999998888888888665449*************************************************** PP DUF2370 123 qygfsm 128 ++ + + SwissProt::Q91ZP6 249 KWILIV 254 986655 PP == domain 3 score: 9.9 bits; conditional E-value: 3e-05 DUF2370 186 sewlayvlmilGlfiliksivdylrvkrleklvlqs 221 + wl +++ +lGl++ ++ +v+yl+v+ + +++ ++ SwissProt::Q91ZP6 267 QYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAA 302 679999***********************9988765 PP
Or compare SwissProt::Q91ZP6 to CDD or PaperBLAST