SwissProt::Q91ZP6 has 311 amino acids
Query: NEDD4_Bsd2 [M=130] Accession: PF10176.14 Description: NEDD4/Bsd2 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-31 94.5 15.0 7.1e-24 70.7 7.5 2.3 2 SwissProt::Q91ZP6 Domain annotation for each sequence (and alignments): >> SwissProt::Q91ZP6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.7 7.5 7.1e-24 7.1e-24 1 57 [. 200 256 .. 200 263 .. 0.95 2 ! 28.3 1.0 9.5e-11 9.5e-11 94 128 .. 266 300 .. 256 302 .. 0.90 Alignments for each domain: == domain 1 score: 70.7 bits; conditional E-value: 7.1e-24 NEDD4_Bsd2 1 lpvGnifsflwnllvsfsFqlvGFlltyllhtthAakqGsraGlGltlvkyglivkp 57 l+vGn+ +f+++++++f+F+++GF+l++++++t+A+++G+++G+Gl+l+k++liv+ SwissProt::Q91ZP6 200 LRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRF 256 579****************************************************94 PP == domain 2 score: 28.3 bits; conditional E-value: 9.5e-11 NEDD4_Bsd2 94 ssewlayllmilGlfilirsivdYlkvkreeqlvl 128 + wl++++++lGl++++r++v+Ylkv+++++++ SwissProt::Q91ZP6 266 GQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMA 300 689***************************99876 PP
Or compare SwissProt::Q91ZP6 to CDD or PaperBLAST