SwissProt::Q95P09 has 320 amino acids
Query: DUF725 [M=121] Accession: PF05267.17 Description: Protein of unknown function (DUF725) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-17 48.9 1.6 5e-17 48.3 1.6 1.3 1 SwissProt::Q95P09 Domain annotation for each sequence (and alignments): >> SwissProt::Q95P09 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.3 1.6 5e-17 5e-17 2 119 .. 53 170 .. 52 172 .. 0.98 Alignments for each domain: == domain 1 score: 48.3 bits; conditional E-value: 5e-17 DUF725 2 skeCfeeYlpelnevaeqyeaeytkCestaeeereeidakveeereqlessakelcsalqkCdsitdsldafeCyakagsenlkilysisan 93 +++C+++Y p ++++a++ + + +kC ++ +++ree ++k+e re+l+ ++ ++ + l +C ++ d+l++f+C+++++se+ ++ + SwissProt::Q95P09 53 TVQCYDKYVPLIRQAAAEGKFASDKCAQEGQNAREEETKKSEVIRESLNVKVASIEKGLGACVAKYDVLEYFTCLRDHASESQTAAGEVGKT 144 79****************************************************************************************** PP DUF725 94 AselaaslseeysaidtteeqCtnka 119 ++ + + l+ + i+ +e+ C+++a SwissProt::Q95P09 145 SAVIVEGLNIVLTNIELREKYCIDQA 170 ***********************998 PP
Or compare SwissProt::Q95P09 to CDD or PaperBLAST