SwissProt::Q9AFC6 has 409 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.18
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-20 58.5 1.1 9.2e-20 57.3 1.1 1.6 1 SwissProt::Q9AFC6
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9AFC6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.3 1.1 9.2e-20 9.2e-20 41 117 .. 297 373 .. 283 392 .. 0.87
Alignments for each domain:
== domain 1 score: 57.3 bits; conditional E-value: 9.2e-20
HHHHGGG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE--TTT--HHHHHHHHHHHHH-HH CS
EryCIII-like_C 41 lgvlLptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialpkdeldadslaeavarvledpa 117
+vl + aa++hhGGaG+t+ a aG Pqi +p+ aD++ a rvaelG G+a ++ + +sl++a++ l ++
SwissProt::Q9AFC6 297 QQVLFRRVAAVIHHGGAGTTHVATRAGAPQILVPQIADQPYYAGRVAELGIGVAHDGPTPTFESLSAALTTALAPET 373
5789999************************************************************9998775433 PP
Or compare SwissProt::Q9AFC6 to CDD or PaperBLAST