SwissProt::Q9AFC6 has 409 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.7e-19 54.2 1.4 2.5e-18 52.5 1.4 1.9 1 SwissProt::Q9AFC6
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9AFC6
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.5 1.4 2.5e-18 2.5e-18 41 117 .. 297 373 .. 286 391 .. 0.87
Alignments for each domain:
== domain 1 score: 52.5 bits; conditional E-value: 2.5e-18
EryCIII-like_C 41 lgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpa 117
+vl aa++HhgGag+t+ a +G Pq+++p+ ad++ a rvaelG g++ ++ t +s+ +a++ ++ ++
SwissProt::Q9AFC6 297 QQVLFRRVAAVIHHGGAGTTHVATRAGAPQILVPQIADQPYYAGRVAELGIGVAHDGPTPTFESLSAALTTALAPET 373
5789999************************************************************9998776443 PP
Or compare SwissProt::Q9AFC6 to CDD or PaperBLAST