SwissProt::Q9AFC7 has 408 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.18 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-19 57.0 0.7 2.3e-19 56.0 0.7 1.4 1 SwissProt::Q9AFC7 Domain annotation for each sequence (and alignments): >> SwissProt::Q9AFC7 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.0 0.7 2.3e-19 2.3e-19 36 125 .. 291 379 .. 280 392 .. 0.88 Alignments for each domain: == domain 1 score: 56.0 bits; conditional E-value: 2.3e-19 --S--HHHHGGG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE--TTT--HHHHHHHHHHHHH-HHHHHHHHHH CS EryCIII-like_C 36 vdfvPlgvlLptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialpkdeldadslaeavarvledpayreaaakl 125 +d v +++l + aa++hhG aG+ + a aGvPq+v+p + D++ a rva+lG G+a ++ + +sl++a++ vl ++ r+ a+ + SwissProt::Q9AFC7 291 IDEVNFQALFRRVAAVIHHGSAGTEHVATRAGVPQLVIPRNTDQPYFAGRVAALGIGVAHDGPTPTFESLSAALTTVLAPET-RARAEAV 379 7889999*********************************************************************997543.4444444 PP
Or compare SwissProt::Q9AFC7 to CDD or PaperBLAST