SwissProt::Q9DAD0 has 168 amino acids
Query: DUF3695 [M=101]
Accession: PF12494.12
Description: Protein of unknown function (DUF3695)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7e-40 121.3 0.4 1e-39 120.8 0.4 1.2 1 SwissProt::Q9DAD0
Domain annotation for each sequence (and alignments):
>> SwissProt::Q9DAD0
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.8 0.4 1e-39 1e-39 3 99 .. 31 124 .. 29 126 .. 0.94
Alignments for each domain:
== domain 1 score: 120.8 bits; conditional E-value: 1e-39
DUF3695 3 fknptklaqqlepweRLfstqtlsSvrreayffdpkiPkDsLDfrLaarYdhhteafkekneillqqeTiqdtsgrvlknfptevlsppked 94
+knp +laqq++pw+RL+st+t +S r+ ffd+kiPkD+LDfrLa +Y+hht+afk+k+eill+qeTi+d +g ++ +fp+e+++ p++
SwissProt::Q9DAD0 31 YKNPAHLAQQQDPWSRLSSTPTATSRSRD-TFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQG-TKIQFPGECFHAPSA- 119
89**********************97666.688******************************************.*************99. PP
DUF3695 95 pltsp 99
p+ts+
SwissProt::Q9DAD0 120 PITSR 124
88876 PP
Or compare SwissProt::Q9DAD0 to CDD or PaperBLAST