SwissProt::Q9L4U6 has 443 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-51 158.0 1.4 7.7e-51 158.0 1.4 1.8 2 SwissProt::Q9L4U6 Domain annotation for each sequence (and alignments): >> SwissProt::Q9L4U6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.1 0.12 0.12 55 84 .. 53 82 .. 23 103 .. 0.69 2 ! 158.0 1.4 7.7e-51 7.7e-51 2 145 .] 280 423 .. 279 423 .. 0.98 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.12 EryCIII-like_C 55 gGagstltalsfGvPqvvlpdeadaavrar 84 Ga l + Gv vl+++ad+ + a SwissProt::Q9L4U6 53 VGADPRLDEMVKGVGDAVLSHHADQSLDAD 82 455556666777888888888888887775 PP == domain 2 score: 158.0 bits; conditional E-value: 7.7e-51 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagi 93 vl++v lD E+v++ld+++r l+++pdnvRlvd+vPl++llptcaaivHhgGag++ tal GvPq+ ++ +da ra+r ++lGag+ SwissProt::Q9L4U6 280 LVLKAVEGLDIEVVATLDAEERALLTHVPDNVRLVDHVPLHALLPTCAAIVHHGGAGTWSTALVEGVPQIAMGWIWDAIDRAQRQQALGAGL 371 58999*************************************************************************************** PP EryCIII-like_C 94 vlskdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkleel 145 l+ +e+t + ++ + +++++p+++aaaa+l++e+ +eP+P+ v++ le l SwissProt::Q9L4U6 372 HLPSHEVTVEGLRGRLVRLLDEPSFTAAAARLRAEAESEPTPAQVVPVLERL 423 **********************************************999876 PP
Or compare SwissProt::Q9L4U6 to CDD or PaperBLAST