SwissProt::Q9L9F5 has 379 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-56 175.2 0.5 7.7e-56 174.2 0.5 1.5 1 SwissProt::Q9L9F5 Domain annotation for each sequence (and alignments): >> SwissProt::Q9L9F5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 174.2 0.5 7.7e-56 7.7e-56 2 142 .. 230 369 .. 229 371 .. 0.98 Alignments for each domain: == domain 1 score: 174.2 bits; conditional E-value: 7.7e-56 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagi 93 +ld++++l +E+v+a+de++rp l++lpd+vR ++++Pl++llptc+aivHhgG+gst++a+sfGvPq+v+p++ad++ +a+r++++Gag+ SwissProt::Q9L9F5 230 LLLDELVALGQEVVIAIDESHRPLLGHLPDGVR-AARIPLCDLLPTCTAIVHHGGSGSTMAAASFGVPQLVVPHFADHFTNAERLTAVGAGL 320 689******************************.********************************************************** PP EryCIII-like_C 94 vlskdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkl 142 +l++d+++ ++i +a++ +++d+++ra + +la+e+a +P+P+ va+ l SwissProt::Q9L9F5 321 SLPHDTDDLARISAACELITGDGPHRAISRRLADENARRPTPAVVAEGL 369 *******************************************999876 PP
Or compare SwissProt::Q9L9F5 to CDD or PaperBLAST