PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9VLU6 to PF07896 (DUF1674)

SwissProt::Q9VLU6 has 118 amino acids

Query:       DUF1674  [M=50]
Accession:   PF07896.16
Description: Protein of unknown function (DUF1674)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.7e-25   75.5   3.5    1.7e-25   75.5   3.5    1.6  2  SwissProt::Q9VLU6  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9VLU6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.2   0.1      0.33      0.33       5      18 ..      43      56 ..      40      63 .. 0.55
   2 !   75.5   3.5   1.7e-25   1.7e-25       5      50 .]      73     118 .]      69     118 .] 0.97

  Alignments for each domain:
  == domain 1  score: -2.2 bits;  conditional E-value: 0.33
            DUF1674  5 rraaaakpakefek 18
                       +++++ ++  +f+k
  SwissProt::Q9VLU6 43 EPKTRTEKLMAFQK 56
                       45555555555555 PP

  == domain 2  score: 75.5 bits;  conditional E-value: 1.7e-25
            DUF1674   5 rraaaakpakefekdvnpktgEigGpkgpEPtRygDWerkGrvsDF 50 
                        ++ ++++p k+ ++++np tgEigGp gpEPtRygDWerkGrvsDF
  SwissProt::Q9VLU6  73 HPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118
                        8999****************************************** PP



Or compare SwissProt::Q9VLU6 to CDD or PaperBLAST