SwissProt::Q9W1C5 has 2053 amino acids
Query: DUF3677 [M=81] Accession: PF12432.12 Description: Protein of unknown function (DUF3677) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-35 105.7 2.1 6.5e-35 105.7 2.1 2.7 2 SwissProt::Q9W1C5 Domain annotation for each sequence (and alignments): >> SwissProt::Q9W1C5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.7 2.1 6.5e-35 6.5e-35 1 81 [] 327 407 .. 327 407 .. 0.99 2 ? -2.0 0.1 0.25 0.25 2 63 .. 961 1020 .. 960 1032 .. 0.78 Alignments for each domain: == domain 1 score: 105.7 bits; conditional E-value: 6.5e-35 DUF3677 1 llklLsslcgipevrllvasrleiwlqnpKLvreaqelLlslcvncntssekdsevidaLvklrlKtkalinlftacikel 81 +lk+L++++gi evr+l++srle+w++n KLv+ aq+lL+++c+n++ ++++d+ev+ +Lvk+rlKtk+lin++++c+ke+ SwissProt::Q9W1C5 327 FLKFLCTTSGIAEVRCLSISRLELWIHNGKLVKFAQQLLSYICFNIKGRNTQDNEVLLVLVKMRLKTKPLINHYMSCLKEM 407 8******************************************************************************98 PP == domain 2 score: -2.0 bits; conditional E-value: 0.25 DUF3677 2 lklLsslcgipevrllvasrleiwlqnpKLvreaqelLlslcvncntssekd..sevidaLvkl 63 lk L+ + + ev+ +++++l q + +el+++ + +++++ +d +e++d+ + + SwissProt::Q9W1C5 961 LKSLQQIPHFYEVKPFIIPQLRAACQVEN----CPELIMAYIQFITAHTLNDpvNEMLDHVIDM 1020 67777777777888888888888777666....8999999888888888888878899998888 PP
Or compare SwissProt::Q9W1C5 to CDD or PaperBLAST