SwissProt::Q9XC67 has 461 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-23 67.0 0.1 1.5e-22 66.3 0.1 1.3 1 SwissProt::Q9XC67 Domain annotation for each sequence (and alignments): >> SwissProt::Q9XC67 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.3 0.1 1.5e-22 1.5e-22 25 140 .. 336 451 .. 331 456 .. 0.93 Alignments for each domain: == domain 1 score: 66.3 bits; conditional E-value: 1.5e-22 EryCIII-like_C 25 dlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedp 116 dl+ lp+nv + dfvPlg++lp ++ +v hgG+++ + al +GvP v +p+ + + arr+ael g l + e+t++++ ++v+ d SwissProt::Q9XC67 336 DLGPLPENVLVRDFVPLGDVLPHTDLLVNHGGTSTAMEALAHGVPIVAMPEMPEPRATARRIAELDLGDWLLPGEVTAEKLSGIAQRVLTDD 427 7899******99******************************************************************************** PP EryCIII-like_C 117 ayraaaaklaeeiaaePsPtEvak 140 r++ +++ ei P+ a SwissProt::Q9XC67 428 RIRKGLDRMRGEIRRAGGPAVAAD 451 ************998888875444 PP
Or compare SwissProt::Q9XC67 to CDD or PaperBLAST