SwissProt::Q9XC67 has 461 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.18 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-21 62.9 0.1 2.9e-21 62.1 0.1 1.3 1 SwissProt::Q9XC67 Domain annotation for each sequence (and alignments): >> SwissProt::Q9XC67 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.1 0.1 2.9e-21 2.9e-21 25 136 .. 336 447 .. 325 456 .. 0.93 Alignments for each domain: == domain 1 score: 62.1 bits; conditional E-value: 2.9e-21 S-SS--SSEEE--S--HHHHGGG-SEEEE---HHHHHHHHHTT--EEE---SHHHHHHHHHHHHHTSEEE--TTT--HHHHHHHHHHHHH-H CS EryCIII-like_C 25 dlaslPdnvRlvdfvPlgvlLptcaaivhhGGaGstltalhaGvPqivlpdgaDrlvraqrvaelGaGialpkdeldadslaeavarvledp 116 dl+ lP+nv + dfvPlg++Lp ++ +v hGG+ + + al +GvP + +p+ + + a+r+ael G l + e++a++l+ +rvl d SwissProt::Q9XC67 336 DLGPLPENVLVRDFVPLGDVLPHTDLLVNHGGTSTAMEALAHGVPIVAMPEMPEPRATARRIAELDLGDWLLPGEVTAEKLSGIAQRVLTDD 427 7899**************************************************************************************** PP HHHHHHHHHHHHHHTS--HH CS EryCIII-like_C 117 ayreaaaklaeealaePkPt 136 r++ +++ e P+ SwissProt::Q9XC67 428 RIRKGLDRMRGEIRRAGGPA 447 **********9987666665 PP
Or compare SwissProt::Q9XC67 to CDD or PaperBLAST