SwissProt::T1SH39 has 123 amino acids
Query: TXD17-like_Trx [M=119] Accession: PF06110.15 Description: Thioredoxin domain-containing protein 17-like, thioredoxin domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-46 142.4 0.0 3.1e-46 142.2 0.0 1.0 1 SwissProt::T1SH39 Domain annotation for each sequence (and alignments): >> SwissProt::T1SH39 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 142.2 0.0 3.1e-46 3.1e-46 1 119 [] 8 122 .. 8 122 .. 0.97 Alignments for each domain: == domain 1 score: 142.2 bits; conditional E-value: 3.1e-46 TXD17-like_Trx 1 svkgfeefekkvkelekesktvfilFsgekdteGesWCPdCvkaepvieealkeapedvklvvvdvGdrevWkdpanefRkdpklkltavPt 92 +v+g++ef ++v e ++ k +f++Fsg+kd +G+sWCPdCv+aep+++ + ++pe +++++++vG+r++Wkd n f+k +lkl +vPt SwissProt::T1SH39 8 NVRGYDEFCQAVSE--RKGKDIFAYFSGDKDASGKSWCPDCVTAEPIVRGQMSHLPEGSVFIYCQVGERAYWKDSTNAFKK--TLKLSGVPT 95 589*********99..7789*************************************************************..89******* PP TXD17-like_Trx 93 LlrwkgkkrLeeeqllkssLvellfee 119 Llr++++++L+ee++ k +Lv+++f+e SwissProt::T1SH39 96 LLRYGTPQKLVEEECFKADLVRMMFTE 122 *************************97 PP
Or compare SwissProt::T1SH39 to CDD or PaperBLAST