PaperBLAST – Find papers about a protein or its homologs

 

Align TCDB::Q5DFV8 to PF10233 (Cg6151-P)

TCDB::Q5DFV8 has 195 amino acids

Query:       Cg6151-P  [M=113]
Accession:   PF10233.13
Description: Uncharacterized conserved protein CG6151-P
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      9e-22   63.8  11.4    1.1e-21   63.5  11.4    1.1  1  TCDB::Q5DFV8  


Domain annotation for each sequence (and alignments):
>> TCDB::Q5DFV8  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   63.5  11.4   1.1e-21   1.1e-21       2     104 ..      16     115 ..      15     124 .. 0.92

  Alignments for each domain:
  == domain 1  score: 63.5 bits;  conditional E-value: 1.1e-21
      Cg6151-P   2 GilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatslivaavll 98 
                   Gi +++lc+ +G++ ++++s+ +iv ++l ++ g+vv+++E+P+++ ++p  +kf+efiek+ + + + ++Y + a+++ lsl+ +++s++++ + l
  TCDB::Q5DFV8  16 GIATAVLCFSMGVVCLISISAQCIVGGLLLILIGIVVIILEAPICCSMVPQLHKFNEFIEKR-SPIEKSIFYGIAAILP-LSLC-FGISTLFCGLAL 109
                   8999**********************************************************.999*************.****.999999988877 PP

      Cg6151-P  99 litavl 104
                    + +++
  TCDB::Q5DFV8 110 GACCAF 115
                   666665 PP



Or compare TCDB::Q5DFV8 to CDD or PaperBLAST