TCDB::Q5DFV8 has 195 amino acids
Query: Cg6151-P [M=113] Accession: PF10233.14 Description: Uncharacterized conserved protein CG6151-P Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-22 63.8 11.4 1.1e-21 63.5 11.4 1.1 1 TCDB::Q5DFV8 Domain annotation for each sequence (and alignments): >> TCDB::Q5DFV8 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.5 11.4 1.1e-21 1.1e-21 2 104 .. 16 115 .. 15 124 .. 0.92 Alignments for each domain: == domain 1 score: 63.5 bits; conditional E-value: 1.1e-21 Cg6151-P 2 GilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatslivaavll 98 Gi +++lc+ +G++ ++++s+ +iv ++l ++ g+vv+++E+P+++ ++p +kf+efiek+ + + + ++Y + a+++ lsl+ +++s++++ + l TCDB::Q5DFV8 16 GIATAVLCFSMGVVCLISISAQCIVGGLLLILIGIVVIILEAPICCSMVPQLHKFNEFIEKR-SPIEKSIFYGIAAILP-LSLC-FGISTLFCGLAL 109 8999**********************************************************.999*************.****.999999988877 PP Cg6151-P 99 litavl 104 + +++ TCDB::Q5DFV8 110 GACCAF 115 666665 PP
Or compare TCDB::Q5DFV8 to CDD or PaperBLAST