TCDB::Q9G046 has 124 amino acids
Query: DUF2746 [M=101]
Accession: PF10874.12
Description: Protein of unknown function (DUF2746)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-17 49.6 0.5 2.6e-17 49.4 0.5 1.2 1 TCDB::Q9G046
Domain annotation for each sequence (and alignments):
>> TCDB::Q9G046
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.4 0.5 2.6e-17 2.6e-17 28 99 .. 52 123 .. 14 124 .] 0.88
Alignments for each domain:
== domain 1 score: 49.4 bits; conditional E-value: 2.6e-17
DUF2746 28 wftgrarkhssdigeikeqvcnthdtnlrddldsvkadisdlkeivlqgfhqvnesinlerreriegdrrke 99
rar+ + ei+eq +nthdtn+rddld ++ + d + + + + + e + er eriegd+r++
TCDB::Q9G046 52 KGRERARQIDAKTDEIHEQTVNTHDTNMRDDLDEIRDLVRDGFKQIQRDIGGLREELRTERLERIEGDKRRD 123
4456899999999***************************98888899999******************985 PP
Or compare TCDB::Q9G046 to CDD or PaperBLAST