PaperBLAST – Find papers about a protein or its homologs

 

Align U3IUP4 to PF20173 (ZnF_RZ-type)

U3IUP4 has 2110 amino acids

Query:       ZnF_RZ-type  [M=54]
Accession:   PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.3e-26   77.0   4.1    3.3e-26   77.0   4.1    4.9  4  U3IUP4    


Domain annotation for each sequence (and alignments):
>> U3IUP4  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -7.6   6.4         1         1      24      37 ..    1635    1647 ..    1625    1653 .. 0.80
   2 ?   -9.8   7.4         1         1      24      39 ..    1684    1700 ..    1675    1701 .. 0.72
   3 ?   -5.4   7.7         1         1      15      38 ..    1740    1761 ..    1739    1763 .. 0.83
   4 !   77.0   4.1   3.3e-26   3.3e-26       8      53 ..    2035    2080 ..    2026    2081 .. 0.92

  Alignments for each domain:
  == domain 1  score: -7.6 bits;  conditional E-value: 1
  ZnF_RZ-type   24 eCGrameesrCpeC 37  
                   eCG+a   ++C +C
       U3IUP4 1635 ECGHACS-GSCHTC 1647
                   8999975.678888 PP

  == domain 2  score: -9.8 bits;  conditional E-value: 1
  ZnF_RZ-type   24 eCGrameesrCp.eCga 39  
                   eC +    srC  +Cg+
       U3IUP4 1684 ECQNHCVHSRCKkKCGE 1700
                   67777777888756776 PP

  == domain 3  score: -5.4 bits;  conditional E-value: 1
  ZnF_RZ-type   15 pnGHpYvigeCGrameesrCpeCg 38  
                   ++GHp+ ig CG++   ++C  C 
       U3IUP4 1740 RCGHPC-IGLCGEPCP-NKCLVCD 1761
                   589**8.8******85.6888886 PP

  == domain 4  score: 77.0 bits;  conditional E-value: 3.3e-26
  ZnF_RZ-type    8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53  
                   +ghw+kC+nGH+YvigeCG+ame+srCpeC+a IGG++h+l ++n+
       U3IUP4 2035 RGHWFKCRNGHIYVIGECGGAMERSRCPECHAVIGGTNHALDSTNS 2080
                   89***************************************99986 PP



Or compare U3IUP4 to CDD or PaperBLAST