U3IUP4 has 2110 amino acids
Query: ZnF_RZ-type [M=54] Accession: PF20173.2 Description: RZ type zinc finger domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-26 77.0 4.1 3.3e-26 77.0 4.1 4.9 4 U3IUP4 Domain annotation for each sequence (and alignments): >> U3IUP4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -7.6 6.4 1 1 24 37 .. 1635 1647 .. 1625 1653 .. 0.80 2 ? -9.8 7.4 1 1 24 39 .. 1684 1700 .. 1675 1701 .. 0.72 3 ? -5.4 7.7 1 1 15 38 .. 1740 1761 .. 1739 1763 .. 0.83 4 ! 77.0 4.1 3.3e-26 3.3e-26 8 53 .. 2035 2080 .. 2026 2081 .. 0.92 Alignments for each domain: == domain 1 score: -7.6 bits; conditional E-value: 1 ZnF_RZ-type 24 eCGrameesrCpeC 37 eCG+a ++C +C U3IUP4 1635 ECGHACS-GSCHTC 1647 8999975.678888 PP == domain 2 score: -9.8 bits; conditional E-value: 1 ZnF_RZ-type 24 eCGrameesrCp.eCga 39 eC + srC +Cg+ U3IUP4 1684 ECQNHCVHSRCKkKCGE 1700 67777777888756776 PP == domain 3 score: -5.4 bits; conditional E-value: 1 ZnF_RZ-type 15 pnGHpYvigeCGrameesrCpeCg 38 ++GHp+ ig CG++ ++C C U3IUP4 1740 RCGHPC-IGLCGEPCP-NKCLVCD 1761 589**8.8******85.6888886 PP == domain 4 score: 77.0 bits; conditional E-value: 3.3e-26 ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53 +ghw+kC+nGH+YvigeCG+ame+srCpeC+a IGG++h+l ++n+ U3IUP4 2035 RGHWFKCRNGHIYVIGECGGAMERSRCPECHAVIGGTNHALDSTNS 2080 89***************************************99986 PP
Or compare U3IUP4 to CDD or PaperBLAST