VIMSS10078410 has 453 amino acids
Query: DUF3493 [M=79]
Accession: PF11998.13
Description: Low psii accumulation1 / Rep27
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.1e-31 93.1 0.4 8.5e-31 92.3 0.4 1.4 1 VIMSS10078410
Domain annotation for each sequence (and alignments):
>> VIMSS10078410
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 92.3 0.4 8.5e-31 8.5e-31 2 79 .] 183 260 .. 182 260 .. 0.97
Alignments for each domain:
== domain 1 score: 92.3 bits; conditional E-value: 8.5e-31
DUF3493 2 ekkarLraEakaPfRglRlflYlafaaSaliGalifllrllagrsgaesapeleetlqnlaiqvgvvalmvfLlrler 79
+++ +L +E++aPfRg+R+f+Y+afaa+a+i+++++++rl+++ +g+++ap+l et n ai++g++++mv+L+ +e+
VIMSS10078410 183 RRDLKLISEVRAPFRGVRKFFYFAFAAAAGISMFFTVPRLVQAIRGGDGAPNLLETTGNAAINIGGIVVMVSLFLWEN 260
5788************************************************************************96 PP
Or compare VIMSS10078410 to CDD or PaperBLAST