PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10079355 to PF14364 (DUF4408)

VIMSS10079355 has 308 amino acids

Query:       DUF4408  [M=33]
Accession:   PF14364.11
Description: Domain of unknown function (DUF4408)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      1e-14   40.4   6.4      2e-14   39.4   6.4    1.5  1  VIMSS10079355  


Domain annotation for each sequence (and alignments):
>> VIMSS10079355  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   39.4   6.4     2e-14     2e-14       1      32 [.      35      66 ..      35      66 .. 0.95

  Alignments for each domain:
  == domain 1  score: 39.4 bits;  conditional E-value: 2e-14
        DUF4408  1 PslwsslrswltPpyLFvvlNvIIitIaasSr 32
                   P+++ss+++wl+PpyL+v++NvIIi+  +s r
  VIMSS10079355 35 PIILSSFLTWLKPPYLYVITNVIIIVVGVSYR 66
                   99***********************9998876 PP



Or compare VIMSS10079355 to CDD or PaperBLAST