VIMSS10080414 has 614 amino acids
Query: DUF630 [M=59]
Accession: PF04783.16
Description: Protein of unknown function (DUF630)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-26 78.1 0.2 1.3e-25 75.7 0.1 2.2 2 VIMSS10080414
Domain annotation for each sequence (and alignments):
>> VIMSS10080414
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 75.7 0.1 1.3e-25 1.3e-25 1 58 [. 1 58 [. 1 59 [. 0.99
2 ? -1.3 0.0 0.14 0.14 36 47 .. 463 474 .. 459 476 .. 0.89
Alignments for each domain:
== domain 1 score: 75.7 bits; conditional E-value: 1.3e-25
DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaee 58
MGc+ Skld +av+lCr+R++ l++ +++ yaLA+aH aYl SL++vg aL+rF+++
VIMSS10080414 1 MGCSPSKLDGLPAVSLCRDRCSSLEDTLRRSYALADAHSAYLLSLNTVGPALHRFFQH 58
*******************************************************986 PP
== domain 2 score: -1.3 bits; conditional E-value: 0.14
DUF630 36 aaHvaYlqSLrn 47
+a+++Y+++L+n
VIMSS10080414 463 DAQAQYVKALNN 474
799*******87 PP
Or compare VIMSS10080414 to CDD or PaperBLAST