VIMSS10080558 has 953 amino acids
Query: DUF630 [M=59] Accession: PF04783.16 Description: Protein of unknown function (DUF630) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-31 92.2 0.2 2.5e-29 87.6 0.3 2.8 2 VIMSS10080558 Domain annotation for each sequence (and alignments): >> VIMSS10080558 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.6 0.3 2.5e-29 2.5e-29 1 59 [] 1 59 [. 1 59 [. 0.99 2 ? 1.1 0.0 0.025 0.025 5 26 .. 778 799 .. 776 818 .. 0.83 Alignments for each domain: == domain 1 score: 87.6 bits; conditional E-value: 2.5e-29 DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaeee 59 MGc Sk+dd++ v lCreRk+l+k+a ++R+aLAaaH++Y+qSL +vg++++rF++ee VIMSS10080558 1 MGCGGSKVDDQPLVILCRERKQLIKAASHHRCALAAAHLSYFQSLCDVGDSIKRFVDEE 59 ********************************************************987 PP == domain 2 score: 1.1 bits; conditional E-value: 0.025 DUF630 5 aSklddeeavalCreRkrllkq 26 S++ ++ +C+++++ + + VIMSS10080558 778 PSRVGAPQVFVICKDWQEAMAR 799 68999999999******99976 PP
Or compare VIMSS10080558 to CDD or PaperBLAST