PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10082999 to PF05542 (DUF760)

VIMSS10082999 has 423 amino acids

Query:       DUF760  [M=83]
Accession:   PF05542.16
Description: Protein of unknown function (DUF760)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      6e-31   93.0   0.0    4.9e-25   74.1   0.0    2.8  2  VIMSS10082999  


Domain annotation for each sequence (and alignments):
>> VIMSS10082999  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.1   0.0   4.9e-25   4.9e-25       2      83 .]     141     266 ..     140     266 .. 0.97
   2 !   15.9   0.0   6.7e-07   6.7e-07       2      75 ..     330     412 ..     329     418 .. 0.89

  Alignments for each domain:
  == domain 1  score: 74.1 bits;  conditional E-value: 4.9e-25
         DUF760   2 Llryiqslkpee.vkal............................................skpaspevleaikqtvsgllgllpsesfevtiets 52 
                    L+r+i+++k++e ++al                                            ++ +spev e+i++++s +l+++  ++ + ++++s
  VIMSS10082999 141 LYRRIAEVKEKErRRALeeilyalvvqkfmdanvtlvpsitsssadpsgrvdtwptldgelERLHSPEVYEMIQNHLSIILKNR-TDDLTAVAQIS 235
                    9***********88888*****************************************************************99.89999****** PP

         DUF760  53 rekLaqLlassmmtGYfLrnaeqRleLeksl 83 
                    +  ++q++a+s+m+GYfL++++qR++Lek++
  VIMSS10082999 236 KLGVGQVYAASVMYGYFLKRIDQRFQLEKTM 266
                    *****************************98 PP

  == domain 2  score: 15.9 bits;  conditional E-value: 6.7e-07
         DUF760   2 Llryiqslkpeevkalskpaspevleaikqtvsgllgl.........lpsesfevtietsrekLaqLlassmmtGYfLrnaeq 75 
                    L  y+ s + e++++ + + s e + +i+++ ++l g+           ++s ++ i++s + L +L + ++ +G fL+ +e 
  VIMSS10082999 330 LKTYVMSFDGETLQRYATIRSRESVGIIEKHTEALFGRpeivitpqgTIDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVES 412
                    668999********************************99988776533555569************************9996 PP



Or compare VIMSS10082999 to CDD or PaperBLAST