VIMSS10082999 has 423 amino acids
Query: DUF760 [M=83] Accession: PF05542.16 Description: Protein of unknown function (DUF760) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-31 93.0 0.0 4.9e-25 74.1 0.0 2.8 2 VIMSS10082999 Domain annotation for each sequence (and alignments): >> VIMSS10082999 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.1 0.0 4.9e-25 4.9e-25 2 83 .] 141 266 .. 140 266 .. 0.97 2 ! 15.9 0.0 6.7e-07 6.7e-07 2 75 .. 330 412 .. 329 418 .. 0.89 Alignments for each domain: == domain 1 score: 74.1 bits; conditional E-value: 4.9e-25 DUF760 2 Llryiqslkpee.vkal............................................skpaspevleaikqtvsgllgllpsesfevtiets 52 L+r+i+++k++e ++al ++ +spev e+i++++s +l+++ ++ + ++++s VIMSS10082999 141 LYRRIAEVKEKErRRALeeilyalvvqkfmdanvtlvpsitsssadpsgrvdtwptldgelERLHSPEVYEMIQNHLSIILKNR-TDDLTAVAQIS 235 9***********88888*****************************************************************99.89999****** PP DUF760 53 rekLaqLlassmmtGYfLrnaeqRleLeksl 83 + ++q++a+s+m+GYfL++++qR++Lek++ VIMSS10082999 236 KLGVGQVYAASVMYGYFLKRIDQRFQLEKTM 266 *****************************98 PP == domain 2 score: 15.9 bits; conditional E-value: 6.7e-07 DUF760 2 Llryiqslkpeevkalskpaspevleaikqtvsgllgl.........lpsesfevtietsrekLaqLlassmmtGYfLrnaeq 75 L y+ s + e++++ + + s e + +i+++ ++l g+ ++s ++ i++s + L +L + ++ +G fL+ +e VIMSS10082999 330 LKTYVMSFDGETLQRYATIRSRESVGIIEKHTEALFGRpeivitpqgTIDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVES 412 668999********************************99988776533555569************************9996 PP
Or compare VIMSS10082999 to CDD or PaperBLAST