VIMSS10083429 has 798 amino acids
Query: DUF630 [M=59] Accession: PF04783.16 Description: Protein of unknown function (DUF630) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-29 87.0 2.2 3.8e-29 87.0 2.2 1.9 2 VIMSS10083429 Domain annotation for each sequence (and alignments): >> VIMSS10083429 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.0 2.2 3.8e-29 3.8e-29 1 59 [] 1 59 [. 1 59 [. 0.98 2 ? -3.4 0.1 0.66 0.66 25 42 .. 477 494 .. 464 505 .. 0.65 Alignments for each domain: == domain 1 score: 87.0 bits; conditional E-value: 3.8e-29 DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaeee 59 MGca+Sk+++eeav +C+eRk+l+k+av aR+a+AaaH aY+ +L+n+gaaL+++ ++e VIMSS10083429 1 MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE 59 *******************************************************9876 PP == domain 2 score: -3.4 bits; conditional E-value: 0.66 DUF630 25 kqaveaRyaLAaaHvaYl 42 + + +a+ a + H+ Y+ VIMSS10083429 477 DSLERAKAAVSHLHTRYI 494 555566667777788886 PP
Or compare VIMSS10083429 to CDD or PaperBLAST