PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10084375 to PF05553 (DUF761)

VIMSS10084375 has 344 amino acids

Query:       DUF761  [M=36]
Accession:   PF05553.16
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    9.7e-19   53.0   5.0    1.5e-18   52.4   5.0    1.3  1  VIMSS10084375  


Domain annotation for each sequence (and alignments):
>> VIMSS10084375  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   52.4   5.0   1.5e-18   1.5e-18       1      36 []     307     342 ..     307     342 .. 0.95

  Alignments for each domain:
  == domain 1  score: 52.4 bits;  conditional E-value: 1.5e-18
         DUF761   1 deevDakAEaFIakFreqlrLQRqeSikryqemlaR 36 
                    +ee+++++EaFI+kF+e+++LQR+eS+++y+e   R
  VIMSS10084375 307 QEELNRRVEAFIKKFNEEMKLQRMESLRQYKEITSR 342
                    79******************************8765 PP



Or compare VIMSS10084375 to CDD or PaperBLAST