PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10084654 to PF05542 (DUF760)

VIMSS10084654 has 340 amino acids

Query:       DUF760  [M=83]
Accession:   PF05542.15
Description: Protein of unknown function (DUF760)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    7.3e-50  153.6   4.7    8.5e-29   86.1   1.1    2.2  2  VIMSS10084654  


Domain annotation for each sequence (and alignments):
>> VIMSS10084654  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   86.1   1.1   8.5e-29   8.5e-29       2      83 .]      89     170 ..      88     170 .. 0.99
   2 !   69.1   0.1   1.8e-23   1.8e-23       3      83 .]     244     325 ..     242     325 .. 0.93

  Alignments for each domain:
  == domain 1  score: 86.1 bits;  conditional E-value: 8.5e-29
         DUF760   2 LlryiqslkpeevkalskpaspevleaikqtvsgllgllpsesfevtietsrekLaqLlassmmtGYfLrnaeqRleLeksl 83 
                    Ll+y+q++kpe ++ + k a + v+ea++qtv++++g+lp++ f vt++   e+LaqL++s++mtGY++rna++RleL++sl
  VIMSS10084654  89 LLEYVQNVKPEFMEMFVKRAPKHVVEAMRQTVTNMIGTLPPQFFAVTVTSVAENLAQLMMSVLMTGYMFRNAQYRLELQQSL 170
                    99******************************************************************************97 PP

  == domain 2  score: 69.1 bits;  conditional E-value: 1.8e-23
         DUF760   3 lryiqslkpeevkalskpaspevleaikqtvsgllgll.psesfevtietsrekLaqLlassmmtGYfLrnaeqRleLeksl 83 
                    l+y++sl+p+++k+l+++a ++v  a+++ v+ ll+   p++  + ++ets   La+Ll+++m++GY +rn+e R+++e++l
  VIMSS10084654 244 LEYLKSLEPQNLKELTSTAGEDVAVAMNTFVKRLLAVSdPNQMKTNVTETSAADLAKLLYWLMVVGYSIRNIEVRFDMERVL 325
                    89**********************************9955555559*********************************987 PP



Or compare VIMSS10084654 to CDD or PaperBLAST