VIMSS10088928 has 132 amino acids
Query: GeBP-like_DBD [M=94] Accession: PF04504.20 Description: Glabrous-enhancer-binding protein-like family, DBD domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-11 30.5 0.2 5e-11 29.5 0.2 1.5 1 VIMSS10088928 Domain annotation for each sequence (and alignments): >> VIMSS10088928 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.5 0.2 5e-11 5e-11 49 94 .] 5 49 .. 1 49 [. 0.88 Alignments for each domain: == domain 1 score: 29.5 bits; conditional E-value: 5e-11 GeBP-like_DBD 49 keqlveKirrLkkkyenkakkakgkepsfskphdqklfelskkIWg 94 k q+++ + +Lk+kyen++ ka +++ + + hd ++f+lsk +Wg VIMSS10088928 5 KVQFMKMLASLKRKYENNLVKA-KNGDEHIRLHDLRAFQLSKFVWG 49 78*****************995.566667789*************8 PP
Or compare VIMSS10088928 to CDD or PaperBLAST