VIMSS10089562 has 250 amino acids
Query: DUF778 [M=136] Accession: PF05608.16 Description: Protein of unknown function (DUF778) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-69 216.4 0.1 1.2e-68 216.0 0.1 1.2 1 VIMSS10089562 Domain annotation for each sequence (and alignments): >> VIMSS10089562 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 216.0 0.1 1.2e-68 1.2e-68 1 136 [] 60 195 .. 60 195 .. 1.00 Alignments for each domain: == domain 1 score: 216.0 bits; conditional E-value: 1.2e-68 DUF778 1 lPvvswllPfiGHvgicredGvildFagsyfvsvdklafGavakylqldrekvcspanlageeseeaeeeaereteisyddalrssteefqhesyn 96 lPvvswl+PfiGH+g+credGvildFags+f++vd++afG +a+ylqldr+k+c p+n++g++++ ++++++ +t+ ++d+al+sst++f+h++yn VIMSS10089562 60 LPVVSWLAPFIGHIGLCREDGVILDFAGSNFINVDDFAFGPPARYLQLDRTKCCLPPNMGGHTCKYGFKHTDFGTARTWDNALSSSTRSFEHKTYN 155 7*********************************************************************************************** PP DUF778 97 lftcnchsfvanaLnrlayegseewnvvnlaalvllkgrw 136 +ftcnchsfvan+Lnrl+y gs+ewn+vn+a+l+++kg+w VIMSS10089562 156 IFTCNCHSFVANCLNRLCYGGSMEWNMVNVAILLMIKGKW 195 ***************************************9 PP
Or compare VIMSS10089562 to CDD or PaperBLAST