VIMSS10089587 has 567 amino acids
Query: DUF1771 [M=64]
Accession: PF08590.14
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-23 68.9 9.4 4.7e-23 67.6 9.4 1.7 1 VIMSS10089587
Domain annotation for each sequence (and alignments):
>> VIMSS10089587
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.6 9.4 4.7e-23 4.7e-23 1 64 [] 408 471 .. 408 471 .. 0.99
Alignments for each domain:
== domain 1 score: 67.6 bits; conditional E-value: 4.7e-23
DUF1771 1 YerlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIfeerN 64
Y++lR+eAr++ar+rn +f++A++Ay G++a+Akels +G+ h+ ++++a+ +A eaI+++rN
VIMSS10089587 408 YSELREEARDYARLRNVYFEQARQAYLVGNKALAKELSVKGQLHNMQMKAAHGKAQEAIYRQRN 471
99*************************************************************9 PP
Or compare VIMSS10089587 to CDD or PaperBLAST