VIMSS10090684 has 56 amino acids
Query: DUF4535 [M=45]
Accession: PF15054.10
Description: Domain of unknown function (DUF4535)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-29 86.5 0.1 4.1e-29 86.4 0.1 1.1 1 VIMSS10090684
Domain annotation for each sequence (and alignments):
>> VIMSS10090684
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 86.4 0.1 4.1e-29 4.1e-29 1 45 [] 6 50 .. 6 50 .. 0.99
Alignments for each domain:
== domain 1 score: 86.4 bits; conditional E-value: 4.1e-29
DUF4535 1 slfsFglGtycGiYvAQNYeVPnvkklantglekakeleekyrKp 45
s+fsF++G+++G+Y+AQNY+VPn++kl+ntgl+ ak++ee+yrKp
VIMSS10090684 6 SCFSFITGSVFGVYLAQNYNVPNIRKLTNTGLVVAKHVEENYRKP 50
79******************************************8 PP
Or compare VIMSS10090684 to CDD or PaperBLAST