VIMSS10092933 has 304 amino acids
Query: DUF1751 [M=99]
Accession: PF08551.14
Description: Eukaryotic integral membrane protein (DUF1751)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.5e-36 109.7 6.1 1e-35 108.6 6.1 1.6 1 VIMSS10092933
Domain annotation for each sequence (and alignments):
>> VIMSS10092933
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 108.6 6.1 1e-35 1e-35 1 99 [] 44 142 .. 44 142 .. 0.99
Alignments for each domain:
== domain 1 score: 108.6 bits; conditional E-value: 1e-35
DUF1751 1 PsallpypwtlltasfvelnvfkvlvslltLllggkylErlWgskEllkFilvvnvitnllvvlltlllylvtkseelllvplsGligilvgflva 96
P++++p++w+l+t++++el+v++v++s+++Ll++gk+lE++Wgs+E+lkFi+vvn++t l+v++++++ly++t+ e++l++p++G++g+l+g+lv+
VIMSS10092933 44 PARTIPFAWNLITSGYFELSVYGVVFSTVSLLFMGKFLEPVWGSTEFLKFIFVVNFLTYLCVFVTAIALYYITRLEVYLYMPFAGFHGVLAGLLVG 139
999********************************************************************************************* PP
DUF1751 97 lkQ 99
+kQ
VIMSS10092933 140 IKQ 142
**9 PP
Or compare VIMSS10092933 to CDD or PaperBLAST