VIMSS10095476 has 119 amino acids
Query: KxDL [M=86]
Accession: PF10241.13
Description: Uncharacterized conserved protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-27 80.8 0.1 4.6e-27 80.5 0.1 1.1 1 VIMSS10095476
Domain annotation for each sequence (and alignments):
>> VIMSS10095476
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.5 0.1 4.6e-27 4.6e-27 2 86 .] 16 100 .. 15 100 .. 0.98
Alignments for each domain:
== domain 1 score: 80.5 bits; conditional E-value: 4.6e-27
KxDL 2 lssavdsedldeilalQaqtsgrlnkknreLlelnalsqerlaklrarfkqgtkllkevkkdLesifkkirslkaklakkyPeeY 86
++++v+ edl+++ +lQ+ ++grl+++n+ L++ n+++++++++++ +f++ t+llk++k+dL++if k+rs+k+k+ ++yP+++
VIMSS10095476 16 FKTLVKVEDLNSLRHLQHLILGRLQDSNAVLSHYNEFAENCFSDVSLEFARSTRLLKSMKADLDYIFLKLRSIKSKILATYPDAF 100
889999*****************************************************************************98 PP
Or compare VIMSS10095476 to CDD or PaperBLAST