VIMSS10099112 has 171 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-18 52.0 0.6 3.8e-18 51.2 0.6 1.4 1 VIMSS10099112
Domain annotation for each sequence (and alignments):
>> VIMSS10099112
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 51.2 0.6 3.8e-18 3.8e-18 3 32 .. 135 164 .. 133 166 .. 0.94
Alignments for each domain:
== domain 1 score: 51.2 bits; conditional E-value: 3.8e-18
DUF761 3 evDakAEaFIakFreqlrLQRqeSikryqe 32
vD +AE+FIakF+eq++LQRq S+++y++
VIMSS10099112 135 GVDVRAEEFIAKFYEQIKLQRQVSYLKYKQ 164
79**************************98 PP
Or compare VIMSS10099112 to CDD or PaperBLAST