VIMSS10099532 has 303 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-16 46.2 0.8 2.9e-16 45.1 0.8 1.5 1 VIMSS10099532
Domain annotation for each sequence (and alignments):
>> VIMSS10099532
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 45.1 0.8 2.9e-16 2.9e-16 1 31 [. 264 294 .. 264 295 .. 0.96
Alignments for each domain:
== domain 1 score: 45.1 bits; conditional E-value: 2.9e-16
DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryq 31
+ee++ ++EaFI kF+++++LQR+eS +ry+
VIMSS10099532 264 REELNSRVEAFITKFKDEMKLQRLESVRRYK 294
59****************************7 PP
Or compare VIMSS10099532 to CDD or PaperBLAST