VIMSS10099532 has 303 amino acids
Query: DUF761 [M=36] Accession: PF05553.16 Description: Cotton fibre expressed protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-16 46.2 0.8 2.9e-16 45.1 0.8 1.5 1 VIMSS10099532 Domain annotation for each sequence (and alignments): >> VIMSS10099532 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.1 0.8 2.9e-16 2.9e-16 1 31 [. 264 294 .. 264 295 .. 0.96 Alignments for each domain: == domain 1 score: 45.1 bits; conditional E-value: 2.9e-16 DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryq 31 +ee++ ++EaFI kF+++++LQR+eS +ry+ VIMSS10099532 264 REELNSRVEAFITKFKDEMKLQRLESVRRYK 294 59****************************7 PP
Or compare VIMSS10099532 to CDD or PaperBLAST