VIMSS10100824 has 359 amino acids
Query: GDT1 [M=75] Accession: PF01169.24 Description: Divalent cation/proton antiporter GDT1 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-44 135.7 22.1 6.8e-27 80.0 7.7 2.4 2 VIMSS10100824 Domain annotation for each sequence (and alignments): >> VIMSS10100824 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.5 6.5 4.1e-21 4.1e-21 2 75 .] 148 226 .. 147 226 .. 0.88 2 ! 80.0 7.7 6.8e-27 6.8e-27 1 75 [] 277 351 .. 277 351 .. 0.98 Alignments for each domain: == domain 1 score: 61.5 bits; conditional E-value: 4.1e-21 GDT1 2 tsflliflaElGDkTqlatiaLAarykplaVflGatlAlalatllavllGsllakrlperlv......klvaallFlvfG 75 ++f+lif++E+GDkT++++++LA++y+ V+lG++ Al l+t+l+v++G+ + + +p+++ +++a +l+++fG VIMSS10100824 148 AAFSLIFVSEIGDKTFFIAALLAMQYEKTLVLLGSMGALSLMTILSVVIGKIF-QSVPAQFQttlpigEYAAIALLMFFG 226 79************************99**********************999.78888776455666777777777776 PP == domain 2 score: 80.0 bits; conditional E-value: 6.8e-27 GDT1 1 ltsflliflaElGDkTqlatiaLAarykplaVflGatlAlalatllavllGsllakrlperlvklvaallFlvfG 75 ++sf+l+f+aE+GD+++lat+aL+a ++pl+V Ga++++++at+la+++G++la++++e+lv +v+++lFlvf+ VIMSS10100824 277 WKSFSLVFFAEWGDRSMLATVALGAAQSPLGVASGAIAGHLVATVLAIMGGAFLANYISEKLVGYVGGALFLVFA 351 579***********************************************************************7 PP
Or compare VIMSS10100824 to CDD or PaperBLAST