VIMSS10102352 has 62 amino acids
Query: DUF4516 [M=46]
Accession: PF14990.10
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.6e-25 72.9 0.0 7.6e-25 72.7 0.0 1.1 1 VIMSS10102352
Domain annotation for each sequence (and alignments):
>> VIMSS10102352
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 72.7 0.0 7.6e-25 7.6e-25 1 46 [] 9 52 .. 9 52 .. 0.97
Alignments for each domain:
== domain 1 score: 72.7 bits; conditional E-value: 7.6e-25
DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekkee 46
+P+G+++++++++v +v+S+laGA+vVHn+YKPdlt+p+ie++e+
VIMSS10102352 9 KPTGTPSLAWSTVV--VVASLLAGASVVHNIYKPDLTLPQIENDEG 52
5*************..**************************9985 PP
Or compare VIMSS10102352 to CDD or PaperBLAST