PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10102634 to PF05078 (DUF679)

VIMSS10102634 has 165 amino acids

Query:       DUF679  [M=163]
Accession:   PF05078.16
Description: Protein of unknown function (DUF679)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.3e-40  123.2   0.0      7e-40  122.8   0.0    1.1  1  VIMSS10102634  


Domain annotation for each sequence (and alignments):
>> VIMSS10102634  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  122.8   0.0     7e-40     7e-40      64     162 ..      61     159 ..      57     160 .. 0.97

  Alignments for each domain:
  == domain 1  score: 122.8 bits;  conditional E-value: 7e-40
         DUF679  64 gkvyyglatlkglwvfdaekekekeelskyrlrflDfvhAvlsvlvFlavalldknvvkCffpkaeeetkellkalPlvvgvlasllfvvfPtkRh 159
                    ++ +yglat++gl+v+d++ + ++ee++ky+l++lDf+hA++s+lvF+av+++d+nv++C+fp ++eetke+l++lP+v+gv+++++f++fPt+Rh
  VIMSS10102634  61 QTARYGLATWSGLLVMDGSITLTEEEKEKYKLKILDFIHAIMSMLVFFAVSMFDQNVTRCLFPVPSEETKEILTSLPFVIGVICGAFFLAFPTRRH 156
                    6789******************9************************************************************************* PP

         DUF679 160 giG 162
                    giG
  VIMSS10102634 157 GIG 159
                    **9 PP



Or compare VIMSS10102634 to CDD or PaperBLAST