VIMSS10102664 has 347 amino acids
Query: DUF3493 [M=79]
Accession: PF11998.13
Description: Low psii accumulation1 / Rep27
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-27 81.6 0.6 3.1e-27 80.9 0.6 1.3 1 VIMSS10102664
Domain annotation for each sequence (and alignments):
>> VIMSS10102664
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.9 0.6 3.1e-27 3.1e-27 3 79 .] 93 169 .. 91 169 .. 0.97
Alignments for each domain:
== domain 1 score: 80.9 bits; conditional E-value: 3.1e-27
DUF3493 3 kkarLraEakaPfRglRlflYlafaaSaliGalifllrllagrsgaesapeleetlqnlaiqvgvvalmvfLlrler 79
+ar+r+E+ +PfR++R+f+Ylaf+aS+ +G+li+++rl+ ++++ +++ e+ e ++ l++++g+ +l++fL++ e+
VIMSS10102664 93 ADARIRSEVLSPFRSVRMFFYLAFIASGSLGGLIATSRLIGALANPARSGEVLEIVKGLGVDIGAASLFAFLYFNEN 169
689**********************************************************************9985 PP
Or compare VIMSS10102664 to CDD or PaperBLAST