PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10104366 to PF11961 (DUF3475)

VIMSS10104366 has 599 amino acids

Query:       DUF3475  [M=57]
Accession:   PF11961.12
Description: Domain of unknown function (DUF3475)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    7.5e-31   92.3   0.8    1.9e-30   91.1   0.8    1.8  1  VIMSS10104366  


Domain annotation for each sequence (and alignments):
>> VIMSS10104366  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.1   0.8   1.9e-30   1.9e-30       1      57 []      28      84 ..      28      84 .. 0.98

  Alignments for each domain:
  == domain 1  score: 91.1 bits;  conditional E-value: 1.9e-30
        DUF3475  1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57
                   +LAFEvA+l+sKlvhLwqsLsdk+varLr+ei++s G+kkLvSeD++f++rL+  E+
  VIMSS10104366 28 VLAFEVASLLSKLVHLWQSLSDKNVARLRDEITHSTGIKKLVSEDDDFIVRLIRDEM 84
                   8****************************************************9886 PP



Or compare VIMSS10104366 to CDD or PaperBLAST