VIMSS10104366 has 599 amino acids
Query: DUF3475 [M=57] Accession: PF11961.12 Description: Domain of unknown function (DUF3475) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-31 92.3 0.8 1.9e-30 91.1 0.8 1.8 1 VIMSS10104366 Domain annotation for each sequence (and alignments): >> VIMSS10104366 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.1 0.8 1.9e-30 1.9e-30 1 57 [] 28 84 .. 28 84 .. 0.98 Alignments for each domain: == domain 1 score: 91.1 bits; conditional E-value: 1.9e-30 DUF3475 1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57 +LAFEvA+l+sKlvhLwqsLsdk+varLr+ei++s G+kkLvSeD++f++rL+ E+ VIMSS10104366 28 VLAFEVASLLSKLVHLWQSLSDKNVARLRDEITHSTGIKKLVSEDDDFIVRLIRDEM 84 8****************************************************9886 PP
Or compare VIMSS10104366 to CDD or PaperBLAST