VIMSS10104611 has 209 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.4e-18 50.4 0.2 1e-17 49.8 0.2 1.3 1 VIMSS10104611
Domain annotation for each sequence (and alignments):
>> VIMSS10104611
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.8 0.2 1e-17 1e-17 2 36 .] 173 207 .. 172 207 .. 0.98
Alignments for each domain:
== domain 1 score: 49.8 bits; conditional E-value: 1e-17
DUF761 2 eevDakAEaFIakFreqlrLQRqeSikryqemlaR 36
+e+D++A++FIa+++e+++L++ +S++r+q+ l+R
VIMSS10104611 173 NEIDKLADRFIANCHEKFMLEKVDSYRRSQGTLNR 207
79********************************8 PP
Or compare VIMSS10104611 to CDD or PaperBLAST