VIMSS10104611 has 209 amino acids
Query: DUF761 [M=36] Accession: PF05553.16 Description: Cotton fibre expressed protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-18 50.4 0.2 1e-17 49.8 0.2 1.3 1 VIMSS10104611 Domain annotation for each sequence (and alignments): >> VIMSS10104611 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.2 1e-17 1e-17 2 36 .] 173 207 .. 172 207 .. 0.98 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 1e-17 DUF761 2 eevDakAEaFIakFreqlrLQRqeSikryqemlaR 36 +e+D++A++FIa+++e+++L++ +S++r+q+ l+R VIMSS10104611 173 NEIDKLADRFIANCHEKFMLEKVDSYRRSQGTLNR 207 79********************************8 PP
Or compare VIMSS10104611 to CDD or PaperBLAST