VIMSS10104823 has 649 amino acids
Query: DUF3475 [M=57]
Accession: PF11961.12
Description: Domain of unknown function (DUF3475)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-27 81.7 2.0 2.2e-27 81.2 0.4 2.2 2 VIMSS10104823
Domain annotation for each sequence (and alignments):
>> VIMSS10104823
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.2 0.4 2.2e-27 2.2e-27 1 57 [] 151 207 .. 151 207 .. 0.99
2 ? -2.3 0.0 0.26 0.26 9 12 .. 334 337 .. 315 345 .. 0.52
Alignments for each domain:
== domain 1 score: 81.2 bits; conditional E-value: 2.2e-27
DUF3475 1 iLAFEvAnlmsKlvhLwqsLsdkevarLreeilrseGVkkLvSeDesfLlrLalaEk 57
iLAFEvAn+++K +L++sLs++++++L+ il seGV++LvS+D ++LlrL++a+k
VIMSS10104823 151 ILAFEVANTIVKSSNLIESLSKRNIEHLKGTILYSEGVQNLVSNDFDELLRLVAADK 207
9******************************************************97 PP
== domain 2 score: -2.3 bits; conditional E-value: 0.26
DUF3475 9 lmsK 12
+m K
VIMSS10104823 334 VMEK 337
4455 PP
Or compare VIMSS10104823 to CDD or PaperBLAST