VIMSS10105292 has 402 amino acids
Query: DUF155 [M=173] Accession: PF02582.18 Description: RMND1/Sif2-Sif3/Mrx10, DUF155 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-37 113.1 0.1 1.5e-36 112.3 0.1 1.5 1 VIMSS10105292 Domain annotation for each sequence (and alignments): >> VIMSS10105292 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.3 0.1 1.5e-36 1.5e-36 1 172 [. 182 352 .. 182 353 .. 0.93 Alignments for each domain: == domain 1 score: 112.3 bits; conditional E-value: 1.5e-36 DUF155 1 vfvfryGvvVfwglteeeekeflkklkkfaeeeskseeeeeetEeleyvyde..ke.srikndlivlesdsllaklaiShalaqSvkLsvlEesle 93 ++vf+yG++V++++ e+e +e+lk ++++a++ + e++++e+e ++++ ++ ++ +d+i l+ +++ +++i +l qS++L+++ ++++ VIMSS10105292 182 MVVFHYGSIVLFNVREHEVDEYLKVVERHASGL----LPEMRKDEYEVRENPnlDTwMEVGRDFIRLQFLNTDGIRTIGCVLGQSIALDYYGRQVD 273 69***************************8885....4444457777777779988899********8888************************* PP DUF155 94 kllestesipeeLaktgklklsrkellkkiGellklradlnlkselldtPdlfWeepeleklYealseyleikeRievL 172 ++ ++++i+++L+ tg+ +++rk+l++++G+++ + ad++lk+ l++++d++W+++++ +++e l++++e+ + + L VIMSS10105292 274 GMVAEFTEINRQLEITGTFTMKRKKLFQLVGKANVILADVILKLGLFERSDIAWKDAKYGQIWEFLRDEFELTQSFANL 352 *****************99*****************************************************9988776 PP
Or compare VIMSS10105292 to CDD or PaperBLAST