PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10105439 to PF05542 (DUF760)

VIMSS10105439 has 355 amino acids

Query:       DUF760  [M=83]
Accession:   PF05542.15
Description: Protein of unknown function (DUF760)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.7e-52  162.1   1.2      3e-27   81.2   0.2    2.8  2  VIMSS10105439  


Domain annotation for each sequence (and alignments):
>> VIMSS10105439  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.0   0.0   1.4e-26   1.4e-26       5      83 .]      83     161 ..      79     161 .. 0.96
   2 !   81.2   0.2     3e-27     3e-27       1      82 [.     251     351 ..     251     352 .. 0.92

  Alignments for each domain:
  == domain 1  score: 79.0 bits;  conditional E-value: 1.4e-26
         DUF760   5 yiqslkpeevkalskpaspevleaikqtvsgllgllpsesfevtietsrekLaqLlassmmtGYfLrnaeqRleLeksl 83 
                     +++++p + + +sk  s  +++++kqt+s++lgllps++f+v++++s++ L +Ll+ss++tGY+L+nae+R++L++++
  VIMSS10105439  83 LVNRIQPLDTSVISKGLSDSAKDSMKQTISSMLGLLPSDQFSVSVTISEQPLYRLLISSIITGYTLWNAEYRVSLRRNF 161
                    68899**********************************************************************9985 PP

  == domain 2  score: 81.2 bits;  conditional E-value: 3e-27
         DUF760   1 eLlryiqslkpeevkalskpaspevleaikqtvsgllgl...................lpsesfevtietsrekLaqLlassmmtGYfLrnaeqRl 77 
                    +Ll+y++sl+pe+v++ls+ +spev+e+++q+v+++l++                      ++    + tsr++La+Ll+++m++G++Lr++e+Rl
  VIMSS10105439 251 DLLDYLRSLDPEMVTELSQLSSPEVEEIVNQLVQNVLERlfedqttsnfmqnpgirttEGGDGTGRKVDTSRDYLAKLLFWCMLLGHHLRGLENRL 346
                    69*************************************99**9999999999985433555555******************************* PP

         DUF760  78 eLeks 82 
                    +L+++
  VIMSS10105439 347 HLSCV 351
                    **986 PP



Or compare VIMSS10105439 to CDD or PaperBLAST