VIMSS10105763 has 106 amino acids
Query: DUF5323 [M=62]
Accession: PF17257.6
Description: Family of unknown function (DUF5323)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.9e-41 123.8 1.9 1.4e-40 123.4 1.9 1.1 1 VIMSS10105763
Domain annotation for each sequence (and alignments):
>> VIMSS10105763
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 123.4 1.9 1.4e-40 1.4e-40 2 60 .. 32 90 .. 31 92 .. 0.92
Alignments for each domain:
== domain 1 score: 123.4 bits; conditional E-value: 1.4e-40
DUF5323 2 gkgglviecSSRPqKKataHHmKtRPrKtqawDirRkPtvYapLPpLPpdwtlvssaed 60
g+ g+viecSSRPqKK+taHH+KtRP+Ktq+wDi+RkPtvYapLPpLP++w+ + a+d
VIMSS10105763 32 GGLGMVIECSSRPQKKSTAHHRKTRPKKTQPWDIKRKPTVYAPLPPLPAEWSPFTLASD 90
6789***********************************************98776665 PP
Or compare VIMSS10105763 to CDD or PaperBLAST