VIMSS10106327 has 435 amino acids
Query: DUF1771 [M=64]
Accession: PF08590.14
Description: Domain of unknown function (DUF1771)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-17 50.4 8.7 2.3e-17 49.4 8.7 1.5 1 VIMSS10106327
Domain annotation for each sequence (and alignments):
>> VIMSS10106327
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.4 8.7 2.3e-17 2.3e-17 1 60 [. 243 302 .. 243 306 .. 0.97
Alignments for each domain:
== domain 1 score: 49.4 bits; conditional E-value: 2.3e-17
DUF1771 1 YerlRaeArkharkrnelfqkAaeAykrGdgaaAkelseeGkehgekaeeanrqAaeaIf 60
Y ++R++A k +r++++++++A++A++r d+a+Ak++s++++e + ae++n++Aa++I
VIMSS10106327 243 YLSHRKDALKVMRSASNHSRAAQNAFQRYDHASAKQHSDKAREDWLAAEKLNAEAAKKII 302
99********************************************************96 PP
Or compare VIMSS10106327 to CDD or PaperBLAST