PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10108437 to PF04504 (GeBP-like_DBD)

VIMSS10108437 has 152 amino acids

Query:       GeBP-like_DBD  [M=94]
Accession:   PF04504.20
Description: Glabrous-enhancer-binding protein-like family, DBD domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    4.2e-12   33.0   1.0    6.8e-12   32.3   1.0    1.5  1  VIMSS10108437  


Domain annotation for each sequence (and alignments):
>> VIMSS10108437  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.3   1.0   6.8e-12   6.8e-12      15      75 ..      42     101 ..      25     115 .. 0.86

  Alignments for each domain:
  == domain 1  score: 32.3 bits;  conditional E-value: 6.8e-12
  GeBP-like_DBD  15 qglldfksktgkspkddldafyeavkkslsfdvskeqlveKirrLkkkyenkakkakgkep 75 
                    ++++dfk+ t ++p+dd+++ y+++++ +s+dv   ++veK+++Lkkk  +k+   + k+ 
  VIMSS10108437  42 KSMMDFKALTRHNPSDDMTGAYNFLHEYISVDVYSYEFVEKMKSLKKKLIEKMGI-NAKDL 101
                    789*********************************************9998865.44444 PP



Or compare VIMSS10108437 to CDD or PaperBLAST