VIMSS10109195 has 187 amino acids
Query: DUF761 [M=36] Accession: PF05553.16 Description: Cotton fibre expressed protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-21 62.1 2.4 2.3e-21 61.4 2.4 1.3 1 VIMSS10109195 Domain annotation for each sequence (and alignments): >> VIMSS10109195 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.4 2.4 2.3e-21 2.3e-21 1 36 [] 150 185 .. 150 185 .. 0.98 Alignments for each domain: == domain 1 score: 61.4 bits; conditional E-value: 2.3e-21 DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryqemlaR 36 ++e+D+ A+ FI +F++q++LQ++ S+kryqemlaR VIMSS10109195 150 EDEIDHVADLFISRFHKQMKLQKLLSFKRYQEMLAR 185 59*********************************8 PP
Or compare VIMSS10109195 to CDD or PaperBLAST